Anti-Creatine Kinase MM antibody (ab83441)

Overview

  • Product nameAnti-Creatine Kinase MM antibody
    See all Creatine Kinase MM primary antibodies
  • Description
    Rabbit polyclonal to Creatine Kinase MM
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 71-120 (VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD L) of Human CKM (NP_001815).

  • Positive control
    • Human fetal muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab83441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre in peptide based assay is 1/1562500.

Target

Anti-Creatine Kinase MM antibody images

  • Anti-Creatine Kinase MM antibody (ab83441) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG diluted in 1/50000 - 1/100000 as secondary antibody.

    Predicted band size : 43 kDa

References for Anti-Creatine Kinase MM antibody (ab83441)

ab83441 has not yet been referenced specifically in any publications.

Product Wall

I'm glad the information was of help to you.

I can now confirm to you that the antibody ab38178 against CKMM is not likely to be able to detect the horse protein as the immunogen used to raise itonly shares 76% homology. I would therefore sug...

Read More

Thank you for confirming those details. I'm sorry it has taken me some time to get back to you, this has not been a trivial task but I hope I now have the information you were hoping for.

CKMM

For this target, I am still waiting on ...

Read More

Thank you for contacting us.

I have checked the following alignments with the following homology results:
CK BB: human-mouse: 97%
CK MM: human-mouse: 97%
CK MB: human-mouse: 97% - there is no separate sequence for MB as the pr...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"