Overview

  • Product nameAnti-CRIP2 antibody
    See all CRIP2 primary antibodies
  • Description
    Rabbit polyclonal to CRIP2
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 158-207 (TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQ P) of Human CRIP2 (NP_001303)

  • Positive control
    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 22 kDa (predicted molecular weight: 22 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-CRIP2 antibody images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling CRIP2 with ab83489 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of alveolar type I cells. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - CRIP2. Right - Merge.
  • Anti-CRIP2 antibody (ab83489) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 50000

    Predicted band size : 22 kDa
    Observed band size : 22 kDa
    Gel concentration: 12%


  • Predicted band size : 22 kDa
    Western blot analysis of MCF7 cell lysate labeling CRIP2 with ab83489 at 1.0µg/ml.

References for Anti-CRIP2 antibody (ab83489)

ab83489 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"