Overview

  • Product name
  • Description
    Rabbit polyclonal to Cripto1
  • Tested applications
    Suitable for: WB, Flow Cyt, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Cripto1 aa 100-150 (internal sequence). The exact sequence is proprietary.
    Sequence:

    SFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGC D


    Database link: P13385

  • Positive control
    • MDA-MB231 lysate; HeLa and NTERA-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab178560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 21 kDa.
Flow Cyt 1/50. ab171870-Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.
ICC/IF 1/20 - 1/100.

Target

  • Function
    Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
  • Tissue specificity
    Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
  • Sequence similarities
    Contains 1 EGF-like domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CR antibody
    • CRGF antibody
    • Cripto 1 antibody
    • Cripto 1 growth factor antibody
    • cripto antibody
    • Cripto-1 growth factor antibody
    • Cripto1 growth factor antibody
    • Epidermal growth factor like cripto protein CR1 antibody
    • Epidermal growth factor-like cripto protein CR1 antibody
    • TDGF 1 antibody
    • TDGF1 antibody
    • TDGF1_HUMAN antibody
    • Teratocarcinoma derived growth factor 1 antibody
    • Teratocarcinoma-derived growth factor 1 antibody
    see all

Anti-Cripto1 antibody images

  • Anti-Cripto1 antibody (ab178560) at 1/1000 dilution + MDA-MB231 lysate

    Predicted band size : 21 kDa
  • Flow cytometric analysis of NTERA-2 cells labeling Cripto1 with ab178560 at 1/50 dilution, detected using Dylight-488 conjugated goat anti-rabbit IgG secondary.

  • Immunofluorescent analysis of HeLa cells labeling Cripto1 with ab178560 at 1/20 dilution, with Dylight 488 (green). Nuclei were counterstained with DAPI (blue) and tubulin was stained with alpha tubulin (red).

References for Anti-Cripto1 antibody (ab178560)

ab178560 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab178560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up