Overview

  • Product nameAnti-CRLS1 antibody
    See all CRLS1 primary antibodies
  • Description
    Rabbit polyclonal to CRLS1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human CRLS1 aa 107-156 (internal sequence).
    Sequence:

    WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN


    Database link: Q9UJA2

Properties

Applications

Our Abpromise guarantee covers the use of ab105782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 1 µg/ml. Predicted molecular weight: 33 kDa.

Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-CRLS1 antibody images

  • Anti-CRLS1 antibody (ab105782) (0.1 to 1 ug/ml) + Human muscle lysate

    Predicted band size : 33 kDa

References for Anti-CRLS1 antibody (ab105782)

ab105782 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"