Overview

  • Product name
  • Description
    Rabbit polyclonal to CRLS1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human CRLS1 aa 107-156 (internal sequence).
    Sequence:

    WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN


    Database link: Q9UJA2

Properties

Applications

Our Abpromise guarantee covers the use of ab105782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 1 µg/ml. Predicted molecular weight: 33 kDa.

Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-CRLS1 antibody (ab105782) (0.1 to 1 ug/ml) + Human muscle lysate

    Predicted band size : 33 kDa

References

This product has been referenced in:
  • Baati N  et al. Myostatin deficiency is associated with lipidomic abnormalities in skeletal muscles. Biochim Biophys Acta 1862:1044-1055 (2017). WB ; Mouse . Read more (PubMed: 28676454) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up