Anti-CSAG1 antibody - C-terminal (ab178367)

Overview

  • Product name
    Anti-CSAG1 antibody - C-terminal
  • Description
    Rabbit polyclonal to CSAG1 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CSAG1 aa 21-69 (C terminal). The exact sequence is proprietary. (NP_705611.1).
    Sequence:

    QVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPKREKGPVK


    Database link: Q6PB30

  • Positive control
    • Human fetal kidney lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab178367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 9 kDa.

Target

  • Relevance
    This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same protein.
  • Cellular localization
    Expressed in chondrosarcoma, melanoma, cartilage and testis, but not in other normal tissues.
  • Database links
  • Alternative names
    • Cancer/testis antigen 24.1 antibody
    • Cancer/testis antigen CSAGE antibody
    • Cancer/testis antigen family 24, member 1 antibody
    • Chondrosarcoma associated gene 1 antibody
    • CSAG1 antibody
    • CSAGE antibody
    • CT24.1 antibody
    • Putative chondrosarcoma-associated gene 1 protein antibody
    see all

Images

  • Anti-CSAG1 antibody - C-terminal (ab178367) at 1 µg/ml + THP-1 whole cell lysate

    Predicted band size : 9 kDa

References

ab178367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
5000 cells
Gel Running Conditions
Reduced Denaturing (14%)
Sample
Human Cell lysate - whole cell (1299 cells)
Specification
1299 cells
Blocking step
Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 25%
Username

Ms. Jennifer Macion

Verified customer

Submitted Mar 25 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up