Overview

  • Product name
  • Description
    Rabbit polyclonal to CSDE1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human CSDE1 aa 50-100. The exact sequence is proprietary. (NP_001007554.1).
    Sequence:

    FFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEER M


    Database link: O75534

  • Positive control
    • HeLa and 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 89 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.
  • Sequence similarities
    Contains 9 CSD (cold-shock) domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cold shock domain containing E1 RNA binding antibody
    • Cold shock domain containing protein E1 antibody
    • Cold shock domain-containing protein E1 antibody
    • Csde1 antibody
    • CSDE1_HUMAN antibody
    • D1S155E antibody
    • DKFZp779B0247 antibody
    • DKFZp779J1455 antibody
    • FLJ26882 antibody
    • N-ras upstream gene protein antibody
    • NRAS related antibody
    • Nras upstream gene protein antibody
    • NRU antibody
    • Protein UNR antibody
    • RP5 1000E10.3 antibody
    • UNR antibody
    • UNR protein antibody
    • Upstream of NRAS antibody
    see all

Images

  • Detection of CSDE1 by Western Blot of Immunprecipitate.
    ab176584 at 0.4µg/ml labeling CSDE1 in HeLa whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176584 at 6µg/mg lysate.

    Detection: Chemiluminescence with exposure time of 10 seconds.

  • All lanes : Anti-CSDE1 antibody (ab176584) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 89 kDa


    Exposure time: 10 seconds

References

This product has been referenced in:
  • Ju Lee H  et al. A post-transcriptional program coordinated by CSDE1 prevents intrinsic neural differentiation of human embryonic stem cells. Nat Commun 8:1456 (2017). Read more (PubMed: 29129916) »
  • Phillips SL  et al. Identification of Proteins Bound to Dengue Viral RNA In Vivo Reveals New Host Proteins Important for Virus Replication. MBio 7:e01865-15 (2016). Read more (PubMed: 26733069) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up