Overview

  • Product name
  • Description
    Rabbit polyclonal to CSH2
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human CSH2 aa 23-217. NCBI Accession No. NP_001308.1.
    Sequence:

    VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQT SFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANN LVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNS HNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF


    Database link: P01243

  • Positive control
    • Human placenta tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.60
    Preservative: 0.0975% Sodium azide
    Constituents: 0.2% BSA, 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use a concentration of 2 - 4 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Function
    Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
  • Sequence similarities
    Belongs to the somatotropin/prolactin family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Choriomammotropin antibody
    • chorionic somatomammotropin A antibody
    • Chorionic somatomammotropin B antibody
    • chorionic somatomammotropin hormone 1 (placental lactogen) antibody
    • Chorionic somatomammotropin hormone 2 antibody
    • Chorionic somatomammotropin hormone antibody
    • chorionic somatomammotropin-1 antibody
    • CS 2 antibody
    • CS-1 antibody
    • CS2 antibody
    • CSA antibody
    • CSB antibody
    • CSH_HUMAN antibody
    • CSH1 antibody
    • CSH2 antibody
    • CSMT antibody
    • hCS antibody
    • hCS B antibody
    • hCS-1 antibody
    • HCSB antibody
    • Lactogen antibody
    • mPL II antibody
    • mplII antibody
    • Pl 2 antibody
    • PL antibody
    • Pl2 antibody
    • Placental lactogen antibody
    • Placental lactogen II antibody
    • Prl3b1 antibody
    • Prolactin 3B1 antibody
    • prolactin family 3, subfamily b, member 1 antibody
    • rPLII antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue, labeling CSH2 with ab189882 at 5 µg/ml.

References

ab189882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up