Overview

  • Product name
  • Description
    Rabbit polyclonal to CSK
  • Tested applications
    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human CSK aa 375-425. The exact sequence is proprietary. (NP_004374.1).
    Sequence:

    LLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWH L


    Database link: P41240

  • Positive control
    • Jurkat whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab186050 was affinity purified using an epitope specific to CSK immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    Images

    • Detection of CSK in immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab186050 at 6 µg/mg lysate for IP (Lane 1). Lane 2 represents rabbit IgG IP control. An alternative anti-CSK antibody was used at 1 µg/ml for subsequent western blot detection. Detection: Chemiluminescence with an exposure time of 10 seconds.

    References

    ab186050 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab186050.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up