Overview

  • Product name
  • Description
    Rabbit polyclonal to CSRP1
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human CSRP1 aa 1-193.
    Sequence:

    MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVA VHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRP TTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCG KGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE


    Database link: P21291

  • Positive control
    • Stomach cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab175319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 21 kDa.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast cancer tissue labelling CSRP1 with ab175319 at 1/400. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophageal cancer tissue labelling CSRP1 with ab175319 at 1/400. Magnification: 200x.
  • Anti-CSRP1 antibody (ab175319) at 1/500 dilution + Stomach cell lysate

    Predicted band size : 21 kDa

References

ab175319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up