Overview

  • Product name
    Anti-CWH43 antibody
  • Description
    Rabbit polyclonal to CWH43
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human CWH43 aa 413-501.
    Sequence:

    KAYERKLGKVAPTKEVSAAIWPFRFGYDNEGWSSLERSAHLLNETGADFI TILESDASKPYMGNNDLTMWLGEKLGFYTDFGPSTRYHT


    Database link: Q9H720

  • Positive control
    • Human breast tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol

Target

  • Function
    Involved in lipid remodeling during GPI-anchor maturation.
  • Sequence similarities
    Belongs to the PGAP2IP family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • C130090K23Rik antibody
    • cell wall biogenesis 43 C terminal homolog antibody
    • Cell wall biogenesis protein 43 C-terminal homolog antibody
    • Cwh43 antibody
    • CWH43 C antibody
    • FLJ21511 antibody
    • imds 60 antibody
    • PG2IP_HUMAN antibody
    • PGAP2 interacting protein antibody
    • PGAP2-interacting protein antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human breast tissue, labeling CWH43 with ab185120 at 1/500 dilution.

References

ab185120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up