Anti-CXXC5 antibody - Aminoterminal end (ab171031)

Overview

  • Product name
    Anti-CXXC5 antibody - Aminoterminal end
    See all CXXC5 primary antibodies
  • Description
    Rabbit polyclonal to CXXC5 - Aminoterminal end
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Guinea pig, Human
  • Immunogen

    Synthetic peptide within Mouse CXXC5 aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD


    Database link: NP_598448

  • Positive control
    • Mouse heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Function
    May indirectly participate in activation of the NF-kappa-B and MAPK pathways. Acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells.
  • Sequence similarities
    Contains 1 CXXC-type zinc finger.
  • Cellular localization
    Nucleus. Cytoplasm. Colocalizes with DVL1 in large bodies localized just outside the nuclear membrane.
  • Information by UniProt
  • Database links
  • Form
    There are 2 isoforms produced by alternative splicing.
  • Alternative names
    • CF5 antibody
    • CXXC finger 5 protein antibody
    • CXXC finger protein 5 antibody
    • CXXC-type zinc finger protein 5 antibody
    • CXXC5 antibody
    • CXXC5_HUMAN antibody
    • HSPC195 antibody
    • Putative MAPK-activating protein PM08 antibody
    • Putative NF-kappa-B-activating protein 102 antibody
    • retinoid-inducible nuclear factor antibody
    • RINF antibody
    • TCCCIA00297 antibody
    • WID antibody
    • WT1-induced Inhibitor of Dishevelled antibody
    see all

Images

  • Anti-CXXC5 antibody - Aminoterminal end (ab171031) at 1 µg/ml + mouse heart lysate at 10 µg

    Predicted band size : 33 kDa

References

ab171031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up