Overview

  • Product nameAnti-CYB5R1 antibody
    See all CYB5R1 primary antibodies
  • Description
    Rabbit polyclonal to CYB5R1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 93-142 (

    LVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKIGD

    ) of Mouse CYB5R1 (NP_082333).

  • Positive control
    • Mouse thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab116276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionNADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesBelongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • b5R.1 antibody
    • B5R1 antibody
    • B5R2 antibody
    • CYB5R1 antibody
    • Cytochrome b5 reductase 1 antibody
    • EC 1.6.2.2 antibody
    • Humb5R2 antibody
    • NAD antibody
    • NAD(P)H:quinone oxidoreductase type 3 polypeptide A2 antibody
    • NAD(P)H:quinone oxidoreductase type 3, polypeptide A2 antibody
    • NADH cytochrome b5 reductase 1 antibody
    • NADH-cytochrome b5 reductase 1 antibody
    • NB5R1_HUMAN antibody
    • NQO3A2 antibody
    • UNQ3049/PRO9865 antibody
    see all

Anti-CYB5R1 antibody images

  • Anti-CYB5R1 antibody (ab116276) at 1 µg/ml + mouse thymus lysate at 10 µg

    Predicted band size : 34 kDa

References for Anti-CYB5R1 antibody (ab116276)

ab116276 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"