Overview

  • Product name
  • Description
    Rabbit polyclonal to CYB5RL
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 72-121 (LNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD D) of Human CYB5RL (NP_001026842).

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
  • Sequence similarities
    Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 Oxidoreductase-like domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2810410C14Rik antibody
    • Cyb5rl antibody
    • Cytochrome b5 reductase-like antibody
    • EC 1.6.2.2 antibody
    • FLJ00377 antibody
    • mFLJ00377 antibody
    • NADH-cytochrome b5 reductase-like antibody
    • NB5R5_HUMAN antibody
    • RP23-97J2.4 antibody
    see all

Images

  • Anti-CYB5RL antibody (ab94435) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 36 kDa

References

ab94435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up