
  • Product name
  • Description
    Rabbit polyclonal to CYB5RL
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 72-121 (LNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD D) of Human CYB5RL (NP_001026842).

  • Positive control
    • HT1080 cell lysate



Our Abpromise guarantee covers the use of ab94435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
  • Sequence similarities
    Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 Oxidoreductase-like domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2810410C14Rik antibody
    • Cyb5rl antibody
    • Cytochrome b5 reductase-like antibody
    • EC antibody
    • FLJ00377 antibody
    • mFLJ00377 antibody
    • NADH-cytochrome b5 reductase-like antibody
    • NB5R5_HUMAN antibody
    • RP23-97J2.4 antibody
    see all

Anti-CYB5RL antibody images

  • Anti-CYB5RL antibody (ab94435) at 1 µg/ml + HT1080 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 36 kDa

References for Anti-CYB5RL antibody (ab94435)

ab94435 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94435.
Please use the links above to contact us or submit feedback about this product.


Sign up