Overview

  • Product name
  • Description
    Mouse polyclonal to Cyclin A1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Full length protein corresponding to Human Cyclin A1 aa 1-464. (ABM85414.1).
    Sequence:

    METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPK SGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGI TRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCS VREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSL GTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWL VEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYE EIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQY LRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNK HFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYL CVSLMEPPAVLLLQ


    Database link: P78396-2

  • Positive control
    • Cyclin A1 transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa.

Target

  • Function
    May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.
  • Tissue specificity
    Very high levels in testis and very low levels in brain. Also found in myeloid Leukemia cell lines.
  • Sequence similarities
    Belongs to the cyclin family. Cyclin AB subfamily.
  • Developmental stage
    Expression increases in early G1 phase and reaches highest levels during the S and G2/M phases.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CCN A1 antibody
    • CCNA 1 antibody
    • Ccna1 antibody
    • CCNA1_HUMAN antibody
    • Cyclin-A1 antibody
    • CyclinA1 antibody
    • G2/mitotic specific cyclin A1 antibody
    • MGC132235 antibody
    • MGC159139 antibody
    see all

Images

  • All lanes : Anti-Cyclin A1 antibody (ab172317) at 1 µg/ml

    Lane 1 : Cyclin A1 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Mouse IgG

    Developed using the ECL technique.

    Predicted band size: 52 kDa

References

This product has been referenced in:
  • Yang L  et al. Transcriptional co-activator with PDZ-binding motif overexpression promotes cell proliferation and transcriptional co-activator with PDZ-binding motif deficiency induces cell cycle arrest in neuroblastoma. Oncol Lett 13:4295-4301 (2017). WB . Read more (PubMed: 28599430) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up