Overview

  • Product nameAnti-Cyclin D1 antibody [CD1.1]See all Cyclin D1 primary antibodies ...
  • Description
    Mouse monoclonal [CD1.1] to Cyclin D1
  • SpecificityThe antibody CD1.1 recognizes cyclin D1, an ubiquitously expressed 33 kDa protein that migrates as a 36 kDa band under reducing SDS-PAGE conditions.
  • Tested applicationsIHC-P, IHC-Fr, Flow Cyt, WB, IP, ELISA, ICCmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow, Dog, Orangutan
  • Immunogen

    Full length protein corresponding to Cyclin D1. Purified cyclin D1 protein.
    Sequence:

    MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQK EVLPSMRKIV ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSR LQLLGATCMFVASKMKETIPLT AEKLCIYTDNSIRPEELLQMELLLVN KLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK HAQTFVALCATDVK FISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD PD CLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRD VDI


    Database link: P24385

  • Positive control
    • Small intestine, colon

Properties

Applications

Our Abpromise guarantee covers the use of ab6152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/10000.

We recommend antigen retrieval with sodium citrate buffer (10mM Sodium Citrate, 0.05% Tween 20, pH 6.0)  before IHC staining.

 

IHC-Fr Use a concentration of 2 µg/ml.
Flow Cyt Use at an assay dependent concentration.

Membrane permeabilization is required.

WB 1/500. Detects a band of approximately 36 kDa (predicted molecular weight: 33 kDa).
IP Use a concentration of 1 µg/ml.
ELISA Use at an assay dependent concentration.
ICC Use a concentration of 1 µg/ml.

Target

  • FunctionEssential for the control of the cell cycle at the G1/S (start) transition.
  • Involvement in diseaseNote=A chromosomal aberration involving CCND1 may be a cause of B-lymphocytic malignancy, particularly mantle-cell lymphoma (MCL). Translocation t(11;14)(q13;q32) with immunoglobulin gene regions. Activation of CCND1 may be oncogenic by directly altering progression through the cell cycle.
    Note=A chromosomal aberration involving CCND1 may be a cause of parathyroid adenomas. Translocation t(11;11)(q13;p15) with the parathyroid hormone (PTH) enhancer.
    Defects in CCND1 are a cause of multiple myeloma (MM) [MIM:254500]. MM is a malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia. Note=A chromosomal aberration involving CCND1 is found in multiple myeloma. Translocation t(11;14)(q13;q32) with the IgH locus.
  • Sequence similaritiesBelongs to the cyclin family. Cyclin D subfamily.
  • Post-translational
    modifications
    Phosphorylation at Thr-286 by MAP kinases is required for ubiquitination and degradation following DNA damage. It probably plays an essential role for recognition by the FBXO31 component of SCF (SKP1-cullin-F-box) protein ligase complex.
    Ubiquitinated, primarily as 'Lys-48'-linked polyubiquitination. Ubiquitinated by a SCF (SKP1-CUL1-F-box protein) ubiquitin-protein ligase complex containing FBXO4 and CRYAB (By similarity). Following DNA damage it is ubiquitinated by some SCF (SKP1-cullin-F-box) protein ligase complex containing FBXO31. Ubiquitination leads to its degradation and G1 arrest. Deubiquitinated by USP2; leading to stabilize it.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • AI327039 antibody
    • B cell ccl/lymphoma 1 antibody
    • B cell CLL/lymphoma 1 antibody
    • B cell leukemia 1 antibody
    • B cell leukemia 1 antibody
    • B cell lymphoma 1 protein antibody
    • B-cell lymphoma 1 protein antibody
    • BCL 1 antibody
    • BCL-1 antibody
    • BCL-1 oncogene antibody
    • BCL1 antibody
    • BCL1 oncogene antibody
    • CCND 1 antibody
    • CCND1 antibody
    • CCND1 protein antibody
    • CCND1/FSTL3 fusion gene, included antibody
    • CCND1/IGHG1 fusion gene antibody
    • CCND1/IGHG1 fusion gene, included antibody
    • CCND1/IGLC1 fusion gene, included antibody
    • CCND1/PTH fusion gene, included antibody
    • CCND1_HUMAN antibody
    • cD1 antibody
    • Cyl 1 antibody
    • D11S287E antibody
    • G1/S specific cyclin D1 antibody
    • G1/S-specific cyclin-D1 antibody
    • Parathyroid adenomatosis 1 antibody
    • PRAD1 antibody
    • PRAD1 oncogene antibody
    • U21B31 antibody
    see all

Anti-Cyclin D1 antibody [CD1.1] images

  • Immunohistochemical analysis of Huh7 tumour xenografts grown in mice treated with either control (left) or anti-Wnt1 antibody (right), staining Cyclin D1 with ab6152. Sections were fixed in acetone before incubation with primary antibody (1/250). Staining was detected using HRP.

References for Anti-Cyclin D1 antibody [CD1.1] (ab6152)

This product has been referenced in:
  • Kim JE  et al. LIM kinase-2 induces programmed necrotic neuronal death via dysfunction of DRP1-mediated mitochondrial fission. Cell Death Differ N/A:N/A (2014). WB, ICC/IF . Read more (PubMed: 24561342) »
  • Shi H  et al. Improved regenerative myogenesis and muscular dystrophy in mice lacking Mkp5. J Clin Invest 123:2064-77 (2013). Flow Cyt ; Mouse . Read more (PubMed: 23543058) »

See all 13 Publications for this product

Product Wall

Application Western blot
Sample Human Cell lysate - whole cell (Human Fibroblast)
Loading amount 15 µg
Specification Human Fibroblast
Gel Running Conditions Reduced Denaturing (4-12% Bis-Tris Nupage gel)
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Feb 25 2013

Application Western blot
Sample Human Cell lysate - whole cell (glioblastoma cells)
Loading amount 50 µg
Specification glioblastoma cells
Gel Running Conditions Non-reduced Denaturing
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted Dec 04 2012

Application Immunohistochemistry (Frozen sections)
Sample Rat Tissue sections (Liver)
Specification Liver
Fixative Acetone
Permeabilization No
Blocking step Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 21°C
Username

Abcam user community

Verified customer

Submitted Nov 29 2012

Thank you for confirming this information and for your help and cooperation with this case.

As requested, I have asked our accounting department to issue you with a credit note. This can then be redeemed against the invoice of a future order...

Read More

Thank you for your message.

I am sorry to hear the suggestions have not improved the results on this occasion. I fully understand the concerns of the customerand it is disappointing the results have not been successful.

We are hap...

Read More

Thank you for taking the time to complete our questionnaire and contact us. I am sorry to hear the customer has had difficulty obtaining satisfactory results from this antibody.

The details you have kindly provided will enable us to investig...

Read More

Thank you for your reply.

All three of these antibodies were validated using a protocol similar to the following:

http://www.abcam.com/index.html?pageconfig=resource&rid=11389

These antibodies were tested using BSA as a...

Read More

Thank you for contacting us.
If we list an antibody as tested, that means the product has been validated for that application and we will cover it under our Abpromise guarantee. If we don't list an application as tested, it generally means that we...

Read More

I have done some reading and for most mammalian antibodies will have a molar extinction coefficient equal to 210,000M-1cm-1. I hope this information helps and please let me know if there is anything else I can do to help.

Thanks for your call yesterday and for your patience while I have been in touch with the lab regarding ab6152. It looks like the antigen retrieval method recommended with this antibody is sodium citrate buffer instead of the standard citric acid...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"