Overview

  • Product nameAnti-Cyclin D3 antibody [DCS2.2]
    See all Cyclin D3 primary antibodies
  • Description
    Mouse monoclonal [DCS2.2] to Cyclin D3
  • Tested applicationsSuitable for: Flow Cyt, WB, IP, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Cyclin D3.
    Sequence:

    MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQR EIKPHMRKML AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQ LQLLGAVCMLLASKLRETTPLT IEKLCIYTDHAVSPRQLRDWEVLVLG KLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK HAQTFLALCATDYT FAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL RA CQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL


    Database link: P30281

Properties

Applications

Our Abpromise guarantee covers the use of ab28283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 1µg for 106 cells. ab170190-Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
WB Use at an assay dependent concentration. Predicted molecular weight: 35 kDa.
IP Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration.

Target

  • FunctionRegulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.
  • Sequence similaritiesBelongs to the cyclin family. Cyclin D subfamily.
    Contains 1 cyclin N-terminal domain.
  • Cellular localizationNucleus. Cytoplasm. Membrane. Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated to the nucleus through interaction with KIP/CIP family members.
  • Information by UniProt
  • Database links
  • Alternative names
    • CCND 3 antibody
    • Ccnd3 antibody
    • CCND3_HUMAN antibody
    • CyclinD3 antibody
    • D3 type cyclin antibody
    • G1 S specific cyclin D3 antibody
    • G1/S specific cyclin D3 antibody
    • G1/S-specific cyclin-D3 antibody
    see all

Anti-Cyclin D3 antibody [DCS2.2] images

  • Overlay histogram showing HeLa cells stained with ab28283 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab28283, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was a goat anti-mouse DyLight® 488 (IgG; H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

  • ab28283 (4µg/ml) staining Cyclin D3 in human pancreas, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong nuclear staining.
    Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer citrate pH6.1 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.
  • All lanes : Anti-Cyclin D3 antibody [DCS2.2] (ab28283) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Nuclear Lysate
    Lane 2 : Jurkat (Human T cell lymphoblast-like cell line) Whole Cell Lysate
    Lane 3 : K562 (Human erythromyeloblastoid leukemia cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    Goat polyclonal Secondary Antibody to Rabbit IgG - H&L (HRP), pre-adsorbed at 1/3000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Predicted band size : 35 kDa
    Observed band size : 35 kDa
    Additional bands at : 75 kDa. We are unsure as to the identity of these extra bands.

    Exposure time : 8 minutes

References for Anti-Cyclin D3 antibody [DCS2.2] (ab28283)

This product has been referenced in:
  • Suwei D  et al. NLK functions to maintain proliferation and stemness of NSCLC and is a target of metformin. J Hematol Oncol 8:120 (2015). Human . Read more (PubMed: 26503334) »
  • Yang J  et al. Recurrent LRP1-SNRNP25 and KCNMB4-CCND3 fusion genes promote tumor cell motility in human osteosarcoma. J Hematol Oncol 7:76 (2014). WB, IHC ; Human . Read more (PubMed: 25300797) »

See all 7 Publications for this product

Product Wall

Thank you for contacting us and I am sorry for the inconveniences.

Due to the small difference in volume observed, it may well be the remaining antibody amount is stuck at the top of the vial, or even through the sides of the vial as a film v...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"