Overview

  • Product nameAnti-Cyclin H antibody
    See all Cyclin H primary antibodies
  • Description
    Rabbit polyclonal to Cyclin H
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 50-99 (PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVME Y) of Human Cyclin H (NP_001230).

  • Positive control
    • HeLa cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab108170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRegulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
  • Sequence similaritiesBelongs to the cyclin family. Cyclin C subfamily.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 6330408H09Rik antibody
    • AI661354 antibody
    • AV102684 antibody
    • AW538719 antibody
    • CAK antibody
    • CAK complex subunit antibody
    • ccnh antibody
    • CCNH_HUMAN antibody
    • CDK activating kinase antibody
    • CDK activating kinase complex subunit antibody
    • Cyclin dependent kinase activating kinase antibody
    • cyclin dependent kinase activating kinase complex subunit antibody
    • Cyclin H antibody
    • Cyclin-H antibody
    • CyclinH antibody
    • MO15 associated protein antibody
    • MO15-associated protein antibody
    • p34 antibody
    • p36 antibody
    • p37 antibody
    see all

Anti-Cyclin H antibody images

  • Anti-Cyclin H antibody (ab108170) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size : 38 kDa

References for Anti-Cyclin H antibody (ab108170)

ab108170 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"