Overview

  • Product name
    Anti-Cyclin J antibody
  • Description
    Rabbit polyclonal to Cyclin J
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 71-120 FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL , of Human Cyclin J (NP_061957).

  • Positive control
    • 721_B cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab104895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    Cyclins are a family of proteins involved in the progression of cells through the cell cycle. Cyclins are so named because their concentration varies in a cyclical fashion during the cell cycle; they are produced or degraded as needed in order to drive the cell through the different stages of the cell cycle. Cyclin J has an RNA expression pattern that suggests a possible role in early embryogenesis.
  • Database links
  • Alternative names
    • bA690P14.1 antibody
    • D430039C20Rik antibody
    • MGC118445 antibody

Anti-Cyclin J antibody images

  • Anti-Cyclin J antibody (ab104895) at 1 µg/ml + 721_B cell lysate at 10 µg

References for Anti-Cyclin J antibody (ab104895)

ab104895 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up