
  • Product name
    Anti-Cyclin J antibody
  • Description
    Rabbit polyclonal to Cyclin J
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 71-120 FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL , of Human Cyclin J (NP_061957).

  • Positive control
    • 721_B cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab104895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    Cyclins are a family of proteins involved in the progression of cells through the cell cycle. Cyclins are so named because their concentration varies in a cyclical fashion during the cell cycle; they are produced or degraded as needed in order to drive the cell through the different stages of the cell cycle. Cyclin J has an RNA expression pattern that suggests a possible role in early embryogenesis.
  • Database links
  • Alternative names
    • bA690P14.1 antibody
    • D430039C20Rik antibody
    • MGC118445 antibody


  • Anti-Cyclin J antibody (ab104895) at 1 µg/ml + 721_B cell lysate at 10 µg

    Gel concentration 12%


ab104895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104895.
Please use the links above to contact us or submit feedback about this product.


Sign up