Overview

  • Product name
  • Description
    Rabbit polyclonal to CYP11A1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CYP11A1 aa 9-146.
    Sequence:

    RSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNG WLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVA LLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAA


    Database link: P05108

  • Positive control
    • IHC-P: Human adrenal gland tissue.

Applications

Our Abpromise guarantee covers the use of ab223700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone.
  • Pathway
    Lipid metabolism; C21-steroid hormone metabolism.
  • Involvement in disease
    Defects in CYP11A1 are a cause of congenital adrenal insufficiency (CAI).
    Defects in CYP11A1 are a cause of congenital lipoid adrenal hyperplasia (CLAH) [MIM:201710]; also known as lipoid CAH. CLAH is the most severe form of adrenal hyperplasia. This autosomal recessive and potentially lethal condition includes the onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. CLAH is a rare disease, except in Japan and Korea where it accounts for a significant percentage of cases of congenital adrenal hyperplasia.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt
  • Database links
    • Alternative names
      • Cholesterol 20 22 desmolase antibody
      • Cholesterol desmolase antibody
      • Cholesterol monooxygenase (side chain cleaving) antibody
      • Cholesterol side chain cleavage enzyme antibody
      • Cholesterol side chain cleavage enzyme mitochondrial antibody
      • Cholesterol side-chain cleavage enzyme antibody
      • CP11A_HUMAN antibody
      • CYP11A antibody
      • CYP11A1 antibody
      • CYPXIA1 antibody
      • Cytochrome P450 11A1 antibody
      • Cytochrome P450 11A1 mitochondrial antibody
      • Cytochrome P450 family 11 subfamily A polypeptide 1 antibody
      • Cytochrome P450 subfamily XIA antibody
      • Cytochrome P450(scc) antibody
      • Cytochrome P450C11A1 antibody
      • mitochondrial antibody
      • P450SCC antibody
      • Steroid 20 22 lyase antibody
      see all

    Images

    • Paraffin-embedded human adrenal gland tissue stained for CYP11A1 using ab223700 at 1/1000 dilution in immunohistochemical analysis.

    References

    ab223700 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab223700.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up