Overview

  • Product name
  • Description
    Rabbit polyclonal to CYP11B1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CYP11B1 aa 1-574. Protein Accession number AAH96285.1.
    Sequence:

    MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWL RLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLW RCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDS LHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHS GCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQN ARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEV MFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELA FSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFE LARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVG LFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWL DIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQE DIKMVYSFILRPSMFPLLTFRAIN


    Database link: AAH96285.1

  • Positive control
    • CYP11B1 transfected 293T cell line.

Applications

Our Abpromise guarantee covers the use of ab171888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Relevance
    This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB. Defects in CYP11B1 are the cause of adrenal hyperplasia type 4 (AH4) [MIM:202010]. AH4 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic). AH4 patients usually have hypertension.
  • Cellular localization
    Mitochondrion inner membrane.
  • Database links
  • Alternative names
    • CPN1 antibody
    • CYP11B antibody
    • CYPXIB1 antibody
    • Cytochrome P 450c11 antibody
    • Cytochrome P450 11B1, mitochondrial antibody
    • Cytochrome p450 XIB1 antibody
    • Cytochrome P450, family 11, subfamily B, polypeptide 1 antibody
    • Cytochrome P450, subfamily XIB (steroid 11 beta hydroxylase), polypeptide 1 antibody
    • Cytochrome P450, subfamily XIB, polypeptide 1 antibody
    • Cytochrome P450C11 antibody
    • FHI antibody
    • P 450C11 antibody
    • P450C11 antibody
    • S11BH antibody
    • Steroid 11 beta hydroxylase antibody
    • Steroid 11 beta monooxygenase antibody
    see all

Images

  • All lanes : Anti-CYP11B1 antibody (ab171888) at 1 µg/ml

    Lane 1 : CYP11B1 transfected 293T cell lysate
    Lane 2 : Non- transfected 293T cell lysate

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 57 kDa

References

ab171888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up