Overview

  • Product nameAnti-CYP2C18 antibody
    See all CYP2C18 primary antibodies
  • Description
    Rabbit polyclonal to CYP2C18
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (

    MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

    ) of Human CYP2C18 (NP_000763).

  • Positive control
    • HT1080 cell lysate

Applications

Our Abpromise guarantee covers the use of ab98026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceCYP2C18 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP2C18 oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Cellular localizationEndoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
  • Database links
  • Alternative names
    • (S) mephenytoin hydroxylase associated cytochrome P450 antibody
    • CPCI antibody
    • CYP2C 18 antibody
    • CYP2C antibody
    • CYP2C17 antibody
    • CYPIIC18 antibody
    • Cytochrome P450 2C18 antibody
    • Cytochrome P450 6B/29C antibody
    • Cytochrome P450 family 2 subfamily C polypeptide 18 antibody
    • Cytochrome P450 subfamily IIC (mephenytoin 4 hydroxylase) polypeptide 17 antibody
    • Cytochrome P450 subfamily IIC (mephenytoin 4 hydroxylase) polypeptide 18 antibody
    • Flavoprotein linked monooxygenase antibody
    • Microsomal monooxygenase antibody
    • P450 6B/29C antibody
    • P450IIC17 antibody
    • Unspecific monooxygenase antibody
    see all

Anti-CYP2C18 antibody images

  • Anti-CYP2C18 antibody (ab98026) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 56 kDa

References for Anti-CYP2C18 antibody (ab98026)

ab98026 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"