
  • Product nameAnti-CYP3A7 antibodySee all CYP3A7 primary antibodies ...
  • Description
    Rabbit polyclonal to CYP3A7
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, African Green Monkey
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 453-502 (KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVS G) of Human CYP3A7 (NP_000756).

  • Positive control
    • HT1080 cell lysate



Our Abpromise guarantee covers the use of ab98025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Cellular localizationEndoplasmic reticulum membrane. Microsome membrane.
  • Target information above from: UniProt accession P24462 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links
  • Alternative names
    • aryl hydrocarbon hydroxylase antibody
    • CP37 antibody
    • CP3A7_HUMAN antibody
    • CYP3A7 antibody
    • CYPIIIA7 antibody
    • Cytochrome P450 3A7 antibody
    • cytochrome P450, family 3, subfamily A, polypeptide 7 antibody
    • cytochrome P450, subfamily IIIA, polypeptide 7 antibody
    • Cytochrome P450-HFLA antibody
    • flavoprotein linked monooxygenase antibody
    • microsomal monooxygenase antibody
    • P450 HFLA antibody
    • xenobiotic monooxygenase antibody
    see all

Anti-CYP3A7 antibody images

  • Anti-CYP3A7 antibody (ab98025) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 58 kDa

References for Anti-CYP3A7 antibody (ab98025)

ab98025 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98025.
Please use the links above to contact us or submit feedback about this product.