Overview

  • Product nameAnti-CYP4F3 antibody
    See all CYP4F3 primary antibodies
  • Description
    Rabbit polyclonal to CYP4F3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (

    LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF

    ) of Human CYP4F3 (NP_000887).

  • Positive control
    • OVCAR-3 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. This enzyme requires molecular oxygen and NADPH for the omega-hydroxylation of LTB4, a potent chemoattractant for polymorphonuclear leukocytes.
  • Tissue specificityExpressed in the polymorphonuclear leukocytes as well as leukocytes.
  • PathwayLipid metabolism; leukotriene B4 degradation.
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Cellular localizationEndoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CP4F3_HUMAN antibody
    • CPF3 antibody
    • CYP4F antibody
    • Cyp4f3 antibody
    • CYPIVF3 antibody
    • Cytochrome P450 4F3 antibody
    • Cytochrome P450 LTB omega antibody
    • Cytochrome P450, family 4, subfamily F, polypeptide 3 antibody
    • Cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase) antibody
    • Cytochrome P450, subfamily IVF, polypeptide 3 antibody
    • Cytochrome P450-LTB-omega antibody
    • Leukotriene B(4) 20 monooxygenase antibody
    • Leukotriene B(4) omega hydroxylase antibody
    • leukotriene B4 omega hydroxylase antibody
    • Leukotriene-B(4) 20-monooxygenase 2 antibody
    • Leukotriene-B(4) omega-hydroxylase 2 antibody
    • leukotriene-B4 20-monooxygenase antibody
    • LTB4 omega-hydroxylase antibody
    • LTB4H antibody
    see all

Anti-CYP4F3 antibody images

  • Anti-CYP4F3 antibody (ab98028) at 1 µg/ml + OVCAR-3 cell lysate

    Predicted band size : 60 kDa

References for Anti-CYP4F3 antibody (ab98028)

ab98028 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"