Overview

  • Product nameAnti-CysLT1 antibody
    See all CysLT1 primary antibodies
  • Description
    Rabbit polyclonal to CysLT1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 199-248 (IIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFM P) of Human CysLT1 (NP_006630).

  • Positive control
    • Human fetal heart lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionReceptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
  • Tissue specificityWidely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon and heart.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CLTR1_HUMAN antibody
    • CYSLT 1 antibody
    • CysLT(1) antibody
    • CYSLT1R antibody
    • CYSLTR 1 antibody
    • CYSLTR antibody
    • CysLTR vide supra antibody
    • CysLTR1 antibody
    • Cysteinyl leukotriene D4 receptor antibody
    • Cysteinyl leukotriene receptor 1 antibody
    • G-protein coupled receptor HG55 antibody
    • HG55 antibody
    • HMTMF81 antibody
    • LTD4 receptor antibody
    • MGC46139 antibody
    see all

Anti-CysLT1 antibody images

  • Anti-CysLT1 antibody (ab122959) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size : 39 kDa

References for Anti-CysLT1 antibody (ab122959)

ab122959 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"