Overview

  • Product name
  • Description
    Rabbit polyclonal to Cystatin A
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Cystatin A aa 1-98.
    Sequence:

    MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAG TNYYIKVRAG DNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF


    Database link: P01040

  • Positive control
    • THP1 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab188502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 11 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function
    This is an intracellular thiol proteinase inhibitor.
  • Sequence similarities
    Belongs to the cystatin family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • AREI antibody
    • cstA antibody
    • Cystatin A antibody
    • Cystatin AS antibody
    • Cystatin-A antibody
    • Cystatin-AS antibody
    • CYTA_HUMAN antibody
    • Stefin A antibody
    • Stefin-A antibody
    • STF1 antibody
    • STFA antibody
    see all

Images

  • Anti-Cystatin A antibody (ab188502) at 1/500 dilution + THP1 cell extract

    Predicted band size: 11 kDa

References

ab188502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up