Anti-Cytochrome P450 3A4 antibody (ab98319)


  • Product name
    Anti-Cytochrome P450 3A4 antibody
    See all Cytochrome P450 3A4 primary antibodies
  • Description
    Rabbit polyclonal to Cytochrome P450 3A4
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, African green monkey
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 395-444 (MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCI G) of Human Cytochrome P450 3A4 (NP_059488).

  • Positive control
    • THP-1 cell lysate.



Our Abpromise guarantee covers the use of ab98319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. The enzyme also hydroxylates etoposide.
  • Tissue specificity
    Expressed in prostate and liver. According to some authors, it is not expressed in brain (PubMed:19094056). According to others, weak levels of expression are measured in some brain locations (PubMed:19359404 and PubMed:18545703). Also expressed in epithelium of the small intestine and large intestine, bile duct, nasal mucosa, kidney, adrenal cortex, epithelium of the gastric mucosa with intestinal metaplasia, gallbladder, intercalated ducts of the pancreas, chief cells of the parathyroid and the corpus luteum of the ovary (at protein level).
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Post-translational
    Polyubiquitinated in the presence of AMFR and UBE2G1 and also STUB1/CHIP and UBE2D1 (in vitro).
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1,8-cineole 2-exo-monooxygenase antibody
    • Albendazole monooxygenase antibody
    • Albendazole sulfoxidase antibody
    • CP33 antibody
    • CP34 antibody
    • CP3A4_HUMAN antibody
    • CYP3 antibody
    • CYP3A antibody
    • CYP3A3 antibody
    • CYP3A4 antibody
    • CYPIIIA3 antibody
    • CYPIIIA4 antibody
    • Cytochrome P450 3A3 antibody
    • Cytochrome P450 3A4 antibody
    • Cytochrome P450 family 3 subfamily A polypeptide 4 antibody
    • Cytochrome P450 HLp antibody
    • Cytochrome P450 NF-25 antibody
    • Cytochrome P450 subfamily IIIA polypeptide 4 antibody
    • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3 antibody
    • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 antibody
    • Cytochrome P450-PCN1 antibody
    • Glucocorticoid inducible P450 antibody
    • HLP antibody
    • MGC126680 antibody
    • NF 25 antibody
    • NF25 antibody
    • Nifedipine oxidase antibody
    • P450 III steroid inducible antibody
    • P450 PCN1 antibody
    • P450, family III antibody
    • P450C3 antibody
    • P450PCN1 antibody
    • Quinine 3 monooxygenase antibody
    • Quinine 3-monooxygenase antibody
    • Taurochenodeoxycholate 6 alpha hydroxylase antibody
    • Taurochenodeoxycholate 6-alpha-hydroxylase antibody
    see all

Anti-Cytochrome P450 3A4 antibody images

  • Anti-Cytochrome P450 3A4 antibody (ab98319) at 1 µg/ml (5% skim milk/PBS buffer) + THP-1 cell lysate at 10 µg

    Predicted band size : 57 kDa

References for Anti-Cytochrome P450 3A4 antibody (ab98319)

ab98319 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98319.
Please use the links above to contact us or submit feedback about this product.


Sign up