Anti-Cytokeratin 18 antibody (FITC) (ab193319)

Overview

  • Product name
    Anti-Cytokeratin 18 antibody (FITC)
    See all Cytokeratin 18 primary antibodies
  • Description
    Rabbit polyclonal to Cytokeratin 18 (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cytokeratin 18 aa 11-430.
    Sequence:

    TNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS G GLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRL ESKIREHLEKKGP QVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDN ARLAADDFRVKYETELAMRQSVEND IHGLRKVIDDTNITRLQLETEIE ALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPK SQDLAKIMADI RAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRR TVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELA QTRAEGQRQAQ EYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDS SNSMQTIQKTTTRRIVDGKVVSE TNDTKVLRH


    Database link: P05783

Properties

Applications

Our Abpromise guarantee covers the use of ab193319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/600. Predicted molecular weight: 48 kDa.

Target

  • Function
    Involved in the uptake of thrombin-antithrombin complexes by hepatic cells (By similarity). When phosphorylated, plays a role in filament reorganization. Involved in the delivery of mutated CFTR to the plasma membrane. Together with KRT8, is involved in interleukin-6 (IL-6)-mediated barrier protection.
  • Tissue specificity
    Expressed in colon, placenta, liver and very weakly in exocervix. Increased expression observed in lymph nodes of breast carcinoma.
  • Involvement in disease
    Defects in KRT18 are a cause of cirrhosis (CIRRH) [MIM:215600].
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Post-translational
    modifications
    Phosphorylation at Ser-34 increases during mitosis. Hyperphosphorylated at Ser-53 in diseased cirrhosis liver. Phosphorylation increases by IL-6.
    Proteolytically cleaved by caspases during epithelial cell apoptosis. Cleavage occurs at Asp-238 by either caspase-3, caspase-6 or caspase-7.
    O-glycosylated at multiple sites; glycans consist of single N-acetylglucosamine residues.
  • Cellular localization
    Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cell proliferation inducing gene 46 protein antibody
    • Cell proliferation inducing protein 46 antibody
    • Cell proliferation-inducing gene 46 protein antibody
    • CK 18 antibody
    • CK-18 antibody
    • CK18 antibody
    • CYK 18 antibody
    • CYK18 antibody
    • Cytokeratin 18 antibody
    • Cytokeratin endo B antibody
    • Cytokeratin-18 antibody
    • K 18 antibody
    • K18 antibody
    • K1C18_HUMAN antibody
    • KA18 antibody
    • Keratin 18 antibody
    • Keratin 18, type I antibody
    • Keratin D antibody
    • keratin, type I cytoskeletal 18 antibody
    • Keratin-18 antibody
    • Krt18 antibody
    see all

References

ab193319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up