Anti-D-cysteine desulfhydrase antibody (Biotin) (ab193061)

Overview

  • Product name
    Anti-D-cysteine desulfhydrase antibody (Biotin)
    See all D-cysteine desulfhydrase primary antibodies
  • Description
    Rabbit polyclonal to D-cysteine desulfhydrase (Biotin)
  • Host species
    Rabbit
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli D-cysteine desulfhydrase aa 2-238.
    Sequence:

    PLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNK LRKLEFLAADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLEN PIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPNAQLEELATRVEAQGF RPYVIPVGGSNALGALGYVESALEIAQQCEGAVNISSVVVASGSAGTHAG LAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAKELELTASAEIL LWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGISQ KRFKDEGPILFIHTGGAPALFAYHPHV


    Database link: P76316

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB 1/500 - 1/5000. Predicted molecular weight: 35 kDa.

Target

  • Relevance
    Catalyzes the alpha,beta-elimination reaction of D-cysteine and of several D-cysteine derivatives. It could be a defense mechanism against D-cysteine. Can also catalyze the degradation of 3-chloro-D-alanine. Belongs to the ACC deaminase/D-cysteine desulfhydrase family.
  • Database links
    • Alternative names
      • D-cysteine desulfhydrase PLP-dependent antibody
      • dcyD antibody
      • ECK1918 antibody
      • JW5313 antibody
      • putative 1-aminocyclopropane-1-carboxylate deaminase antibody
      • yedO antibody
      see all

    Images

    • All lanes : Anti-D-cysteine desulfhydrase antibody (Biotin) (ab193061) at 0.25 µg/ml

      Lane 1 : Rosseta bacteria lysate at 40 µg
      Lane 2 : Rosseta bacteria lysate at 20 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/5000 dilution

      Predicted band size: 35 kDa
      Observed band size: 36 kDa (why is the actual band size different from the predicted?)

    References

    ab193061 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193061.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up