Anti-D-cysteine desulfhydrase antibody (FITC) (ab193038)

Overview

  • Product name
    Anti-D-cysteine desulfhydrase antibody (FITC)
    See all D-cysteine desulfhydrase primary antibodies
  • Description
    Rabbit polyclonal to D-cysteine desulfhydrase (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli D-cysteine desulfhydrase aa 2-328.
    Sequence:

    PLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNK LRKLEFLAADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLEN PIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPNAQLEELATRVEAQGF RPYVIPVGGSNALGALGYVESALEIAQQCEGAVNISSVVVASGSAGTHAG LAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAKELELTASAEIL LWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGISQ KRFKDEGPILFIHTGGAPALFAYHPHV


    Database link: P76316

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/500. Predicted molecular weight: 35 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    Catalyzes the alpha,beta-elimination reaction of D-cysteine and of several D-cysteine derivatives. It could be a defense mechanism against D-cysteine. Can also catalyze the degradation of 3-chloro-D-alanine. Belongs to the ACC deaminase/D-cysteine desulfhydrase family.
  • Database links
    • Alternative names
      • D-cysteine desulfhydrase PLP-dependent antibody
      • dcyD antibody
      • ECK1918 antibody
      • JW5313 antibody
      • putative 1-aminocyclopropane-1-carboxylate deaminase antibody
      • yedO antibody
      see all

    References

    ab193038 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193038.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up