Overview

  • Product name
  • Description
    Rabbit polyclonal to Dab1
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human Dab1 aa 199-248. The exact sequence is proprietary. From Isoform DAB555. NP_066566.3
    Sequence:

    QYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSAVTQLEL


    Database link: O75553-6

  • Positive control
    • Human intestine tissue; MCF7 cells; extracts from HepG2 and 293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab189426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 20 µg/ml.
ICC/IF 1/100 - 1/500.
WB 1/500 - 1/1000. Predicted molecular weight: 60 kDa.

Target

  • Function
    Adapter molecule functioning in neural development. May regulate SIAH1 activity.
  • Sequence similarities
    Contains 1 PID domain.
  • Domain
    The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.
  • Post-translational
    modifications
    Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (By similarity). Also phosphorylated on Ser-524 independently of reelin signaling.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dab 1 antibody
    • Dab reelin signal transducer 1 antibody
    • Dab, reelin signal transducer, homolog 1 (Drosophila) antibody
    • Dab1 antibody
    • DAB1_HUMAN antibody
    • Disabled homolog 1 antibody
    • Disabled homolog 1 Drosophila antibody
    • Scm antibody
    • Scr antibody
    • Scrambler antibody
    • Yot antibody
    • Yotari antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human intestine tissue labeling Dab1 with ab189426 at 20 µg/ml.

  • Immunofluorescent analysis of MCF7 cells labeling Dab1 with ab189426 at 1/100 dilution. The image on the right is treated with the synthesized peptide.

  • All lanes : Anti-Dab1 antibody (ab189426) at 1/500 dilution

    Lane 1 : Extracts from HepG2 cells
    Lane 2 : Extracts from 293 cells
    Lane 3 : Extracts from HepG2 cells treated with the synthesized peptide


    Predicted band size : 60 kDa

References

ab189426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up