Overview

  • Product name
  • Description
    Rabbit polyclonal to DAOA
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DAOA aa 82-152.
    Sequence:

    CPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWT CNYNQQKDQSCNHKEITSTKA


    Database link: P59103

  • Positive control
    • Human kidney, adrenal gland and thyroid cancer tissue; U-251 MG sp cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab188162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 18 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Seems to activate D-amino acid oxidase.
  • Tissue specificity
    Expressed in amygdala, caudate nucleus, spinal cord and testis.
  • Cellular localization
    Golgi apparatus.
  • Information by UniProt
  • Database links
  • Alternative names
    • D-amino acid oxidase activator antibody
    • DAOA antibody
    • DAOA_HUMAN antibody
    • G72 transcript antibody
    • LG72 antibody
    • Protein G72 antibody
    • Schizophrenia and bipolar disorder associated protein G72 antibody
    • SG72 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling DAOA with ab188162 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human adrenal gland tissue labeling DAOA with ab188162 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling DAOA with ab188162 at 1/1000 dilution.

  • All lanes : Anti-DAOA antibody (ab188162) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG sp cell lysate

    Predicted band size: 18 kDa

References

ab188162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up