Overview

  • Product name
  • Description
    Rabbit polyclonal to DAP1
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human DAP1 aa 11-60 (N terminal). The exact sequence is proprietary.
    Sequence:

    TKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFIS


    Database link: P51397

  • Positive control
    • Formalin-Fixed, Paraffin-Embedded Human lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab190156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 15 µg/ml.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung tissue labeling DAP1 with ab190156 at 15 µg/ml.

References

ab190156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up