Overview

  • Product name
  • Description
    Mouse polyclonal to DARC
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Full length protein corresponding to Human DARC aa 1-336. (AAH17817).
    Sequence:

    MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAP CHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLA QLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCH ASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYS TELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWF IFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT PLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS


    Database link: Q16570

  • Positive control
    • DARC transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Function
    Non-specific receptor for many chemokines such as IL-8, GRO, RANTES, MCP-1 and TARC. It is also the receptor for the human malaria parasites Plasmodium vivax and Plasmodium knowlesi.
  • Tissue specificity
    Found in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the principle tissues expressing duffy. Fy(-A-B) individuals do not express duffy in the bone marrow, however they do, in postcapillary venule endothelium.
  • Sequence similarities
    Belongs to the G-protein coupled receptor Duffy family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACKR1 antibody
    • Atypical chemokine receptor 1 antibody
    • CCBP1 antibody
    • CD234 antibody
    • DARC antibody
    • Dfy antibody
    • Duffy antigen/chemokine receptor antibody
    • duffy blood group antibody
    • Duffy blood group antigen antibody
    • Duffy blood group chemokine receptor antibody
    • DUFFY_HUMAN antibody
    • FY antibody
    • Fy glycoprotein antibody
    • Glycoprotein D antibody
    • GPD antibody
    • GpFy antibody
    • Plasmodium vivax receptor antibody
    • WBCQ1 antibody
    see all

Images

  • All lanes : Anti-DARC antibody (ab171904) at 1 µg

    Lane 1 : DARC transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 35 kDa

References

ab171904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up