Overview

  • Product nameAnti-DAZ3 antibody
    See all DAZ3 primary antibodies
  • Description
    Rabbit polyclonal to DAZ3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Guinea pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 216-265 (

    FPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFP

    ) of Human DAZ3 (NP_065097).

  • Positive control
    • OVCAR-3 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab94695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRNA-binding protein that plays an essential role in spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.
  • Tissue specificityTestis specific.
  • Involvement in diseaseSpermatogenic failure Y-linked 2
  • Sequence similaritiesBelongs to the RRM DAZ family.
    Contains 12 DAZ-like domains.
    Contains 1 RRM (RNA recognition motif) domain.
  • DomainThe DAZ-like repeats are essential and mediate the interaction with DAZAP1 and DAZAP2.
  • Cellular localizationCytoplasm. Nucleus. Predominantly cytoplasmic. Nuclear at some stages of spermatozoide development. Localizes both to the nuclei and cytoplasm of spermatozoide differentiation. Nuclear in fetal gonocytes and in spermatogonial nuclei. It then relocates to the cytoplasm during male meiosis.
  • Information by UniProt
  • Database links
  • Alternative names
    • DAZ3 antibody
    • DAZ3_HUMAN antibody
    • deleted in azoospermia 3 antibody
    • Deleted in azoospermia protein 3 antibody
    • MGC126441 antibody
    • pDP1679 antibody
    see all

Anti-DAZ3 antibody images

  • Anti-DAZ3 antibody (ab94695) at 1 µg/ml + OVCAR3 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa

References for Anti-DAZ3 antibody (ab94695)

ab94695 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"