Overview

  • Product name
  • Description
    Rabbit polyclonal to DCAF5
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DCAF5 aa 646-725.
    Sequence:

    RASPTSDIESVERKIYKAYKWLRYSYISYSNNKDGETSLVTGEADEGRAG TSHKDNPAPSSSKEACLNIAMAQRNQDLPP


    Database link: Q96JK2

  • Positive control
    • Human kidney tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab184842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 6 WD repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • BCRG2 antibody
    • BCRP2 antibody
    • Breakpoint cluster region protein 2 antibody
    • Breakpoint cluster region protein, uterine leiomyoma, 2 antibody
    • D14S1461E antibody
    • Dcaf5 antibody
    • DCAF5_HUMAN antibody
    • DDB1 and CUL4 associated factor 5 antibody
    • DDB1- and CUL4-associated factor 5 antibody
    • WD repeat-containing protein 22 antibody
    • WDR22 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling DCAF5 with ab184842 at 1/200 dilution.

References

ab184842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up