Overview

  • Product name
  • Description
    Rabbit polyclonal to DCK
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human DCK aa 210-260. The exact sequence is proprietary. (NP_000779.1).
    Sequence:

    YKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST L


    Database link: P27707

  • Positive control
    • HeLa, 293T, Jurkat, TCMK-1 and NIH 3T3 whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab186128 was affinity purified using an epitope specific to DCK immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 31 kDa.

Target

Images

  • All lanes : Anti-DCK antibody (ab186128) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 31 kDa


    Exposure time: 3 minutes
  • Detection of DCK in immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab186128 at 6 µg per reaction for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with exposure time of 3 minutes.

References

This product has been referenced in:
  • Ma YT  et al. Use of a genome-wide haploid genetic screen to identify treatment predicting factors: a proof-of-principle study in pancreatic cancer. Oncotarget 8:63635-63645 (2017). Read more (PubMed: 28969017) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up