Overview

  • Product name
  • Description
    Rabbit polyclonal to DcR1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DcR1 aa 30-230.
    Sequence:

    ARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNA SNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKC SRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPA AEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETM IT


    Database link: O14798

  • Positive control
    • Human spleen cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab180777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Relevance
    DcR1 / TRAIL-R3 / TRID / LIT is one of the two putative decoy receptors identified for TRAIL, one of the members of TNF family of apoptosis inducing proteins. The other putative decoy receptor is called DcR2 / TRUNDD / TRAIL-R4. DcR1 is attached to the cell surface through glycophospholipid anchor. It has the extracellular TRAIL binding domain but lacks the cytoplasmic domain to induce apoptotic signal. Hence overexpression of DcR1 inhibits the TRAIL induced apoptosis.
  • Cellular localization
    Cell Membrane and Cytoplasmic
  • Database links
  • Alternative names
    • Antagonist decoy receptor for TRAIL/Apo 2L antibody
    • CD263 antibody
    • Cytotoxic TRAIL receptor 3 antibody
    • DCR1 antibody
    • DCR1 TNFR antibody
    • Decoy Receptor 1 antibody
    • Decoy TRAIL receptor without death domain antibody
    • LIT antibody
    • Lymphocyte inhibitor of TRAIL antibody
    • MGC149501 antibody
    • MGC149502 antibody
    • TNF related apoptosis inducing ligand receptor 3 antibody
    • TNF-re ated apoptosis inducing ligand receptor 3 antibody
    • TNFRSF10C antibody
    • TRAIL R3 antibody
    • TRAIL receptor 3 antibody
    • TRAILR3 antibody
    • TRID antibody
    • Tumor necrosis factor receptor superfamily member 10C antibody
    • Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain antibody
    see all

Images

  • Anti-DcR1 antibody (ab180777) at 1/500 dilution + Human spleen cell lysate

    Predicted band size: 27 kDa

References

ab180777 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up