Overview

  • Product nameAnti-DDX51 antibody
    See all DDX51 primary antibodies
  • Description
    Rabbit polyclonal to DDX51
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 301-350 (FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGR L) of Human DDX51 (NP_778236).

  • Positive control
    • 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab108179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 72 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceDDX51 belongs to the DEAD box helicase family. It is thought to be an ATP-binding RNA helicase involved in the biogenesis of 60S ribosomal subunits. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.
  • Cellular localizationNuclear, nucleolus.
  • Database links
  • Alternative names
    • DDX 51 antibody
    • DEAD (Asp Glu Ala Asp) box polypeptide 51 antibody
    • DEAD box protein 51 antibody
    • Dead box protein 73D like antibody
    • MGC42193 antibody
    see all

Anti-DDX51 antibody images

  • Anti-DDX51 antibody (ab108179) at 1 µg/ml + 293T cell lysate at 10 µg

    Predicted band size : 72 kDa

References for Anti-DDX51 antibody (ab108179)

ab108179 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"