Anti-DECTIN 2 antibody [D2.11E4] - Low endotoxin, Azide free (ab157685)

Overview

  • Product name
    Anti-DECTIN 2 antibody [D2.11E4] - Low endotoxin, Azide free
    See all DECTIN 2 primary antibodies
  • Description
    Rat monoclonal [D2.11E4] to DECTIN 2 - Low endotoxin, Azide free
  • Host species
    Rat
  • Tested applications
    Suitable for: IP, IHC-Fr, Flow Cytmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse DECTIN 2 aa 44-209 (extracellular). Fused to Fc protein.
    Sequence:

    IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLI STKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDP QGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVF CDSKHNSICEMKKIYL


    Database link: Q9JKF4-1

  • Positive control
    • Mouse spleen tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Clonality
    Monoclonal
  • Clone number
    D2.11E4
  • Isotype
    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab157685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.
Flow Cyt 1/10 - 1/100.

Use 10 µl of the suggested working dilution to label 106cells in 100 µl.

 

 

 

 

ab18450 - Rat monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    Binds high-mannose carbohydrates in a Ca(2+)-dependent manner. Functional receptor for alpha-mannans on C.albicans hypheas. Plays an important role in the host defense against C.albicans infection by inducing TH17 cell differentiation. Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production. Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptive immune responses. Transduces signals through an Fc receptor gamma chain /FCER1G and Syk-CARD9-NF-kappa-B-dependent pathway.
  • Tissue specificity
    Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather than myeloids.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Domain
    A short stretch of the intracellular domain (AA 8-14) proximal to the transmembrane domain is required for association with Fc receptor gamma chain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • C type lectin domain family 6 member A antibody
    • C type lectin superfamily member 10 antibody
    • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 10 antibody
    • C-type lectin domain family 6 member A antibody
    • C-type lectin superfamily member 10 antibody
    • CLC6A_HUMAN antibody
    • CLEC4N antibody
    • CLEC4N, mouse, homolog of antibody
    • Clec6a antibody
    • CLECSF10 antibody
    • DC associated C type lectin 2 antibody
    • DC-associated C-type lectin 2 antibody
    • Dectin-2 antibody
    • Dectin2 antibody
    • Dendritic cell associated lectin 2 antibody
    • Dendritic cell-associated C-type lectin 2 antibody
    see all

Images

  • Immunohistochemical analysis of frozen mouse spleen tissue, labeling DECTIN 2 using ab157685.

References

ab157685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up