Anti-Dedicator of cytokinesis protein 6 antibody (ab188445)

Overview

  • Product name
    Anti-Dedicator of cytokinesis protein 6 antibody
  • Description
    Rabbit polyclonal to Dedicator of cytokinesis protein 6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Dedicator of cytokinesis protein 6 aa 803-904.
    Sequence:

    GAFEAMAHVVSLVHRSLEAAQDARGHCPQLAAYVHYAFRLPGTEPSLPDG APPVTVQAATLARGSGRPASLYLARSKSISSSNPDLAVAPGSVDDEVSRI LA


    Database link: Q96HP0

  • Positive control
    • Human stomach, pancreas and pancreatic cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Acts as guanine nucleotide exchange factor (GEF) for CDC42 and RAC1 small GTPases. Through its activation of CDC42 and RAC1, may regulate neurite outgrowth.
  • Tissue specificity
    Widely expressed. Expressed at low level in spleen, cerebellum, hippocampus and in substantia nigra.
  • Involvement in disease
    Adams-Oliver syndrome 2
  • Sequence similarities
    Belongs to the DOCK family.
    Contains 1 DHR-1 domain.
    Contains 1 DHR-2 domain.
  • Domain
    The DHR-2 domain may mediate some GEF activity.
  • Cellular localization
    Cytoplasm. Cytoplasm > perinuclear region. Mainly located near the cell surface.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dedicator of cytokinesis protein 6 antibody
    • Dock6 antibody
    • DOCK6_HUMAN antibody

Images

  • Immunohistochemical analysis of paraffin-embedded Human stomach tissue labeling Dedicator of cytokinesis protein 6 with ab188445 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling Dedicator of cytokinesis protein 6 with ab188445 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human pancreatic cancer tissue labeling Dedicator of cytokinesis protein 6 with ab188445 at 1/500 dilution.

References

ab188445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up