Anti-Dehydrodolichyl Diphosphate Synthase antibody (ab85503)

Overview

  • Product nameAnti-Dehydrodolichyl Diphosphate Synthase antibody
    See all Dehydrodolichyl Diphosphate Synthase primary antibodies
  • Description
    Rabbit polyclonal to Dehydrodolichyl Diphosphate Synthase
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 36 - 85 (

    NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR

    ) of Human Dehydrodolichyl Diphosphate Synthase (NP_079163)

  • Positive control
    • Placenta tissue lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG

Applications

Our Abpromise guarantee covers the use of ab85503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Dehydrodolichyl Diphosphate Synthase antibody images

  • Anti-Dehydrodolichyl Diphosphate Synthase antibody (ab85503) at 1 µg/ml + Human placenta lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 39 kDa

References for Anti-Dehydrodolichyl Diphosphate Synthase antibody (ab85503)

ab85503 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"