Overview

  • Product name
  • Description
    Rabbit polyclonal to DENND1B
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human DENND1B aa 617-697. Isoform 5.
    Sequence:

    AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEE NSNKHLGADNVSDPTSGLDFQLTSPEVSQTD


    Database link: Q6P3S1-5

  • Positive control
    • Human cell lines RT-4 & U-251MG sp, Human colon tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 86 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Guanine nucleotide exchange factor (GEF) for RAB35. May function as a clathrin-associated sorting protein for RAB35, whereby during clathrin-mediated endocytosis, binds the AP-2 complex and inactived RAB35, then activates RAB35 for its subsequent function at endosomes.
  • Tissue specificity
    Highly expressed in dendritic and natural killer cells and at lower levels in other myeloid lineage cells and in pituitary. Significantly up-regulated in effector memory T cells as compared with naive T cells.
  • Sequence similarities
    Contains 1 dDENN domain.
    Contains 1 DENN domain.
    Contains 1 uDENN domain.
  • Post-translational
    modifications
    Isoform 5 is phosphorylated on Tyr-475, Tyr-484, Ser-514 and Ser-652.
  • Cellular localization
    Cytoplasm > cytosol. Cytoplasmic vesicle > clathrin-coated vesicle.
  • Information by UniProt
  • Database links
  • Alternative names
    • C1ORF18 antibody
    • C1orf218 antibody
    • Chromosome 1 open reading frame 218 antibody
    • Connecdenn 2 antibody
    • DEN1B_HUMAN antibody
    • DENN domain containing protein 1B antibody
    • DENN domain-containing protein 1B antibody
    • DENN MADD domain containing 1B antibody
    • DENND1B antibody
    • DKFZp547O0715 antibody
    • FAM31B antibody
    • Family with sequence similarity 31 member B antibody
    • FLJ20054 antibody
    • FLJ21179 antibody
    • FLJ33888 antibody
    • MGC103810 antibody
    • MGC27044 antibody
    • Protein FAM31B antibody
    • RP11 53I24.2 antibody
    see all

Images

  • All lanes : Anti-DENND1B antibody (ab187903) at 1/100 dilution

    Lane 1 : Human cell line RT-4
    Lane 2 : Human cell line U-251MG sp

    Developed using the ECL technique

    Predicted band size : 86 kDa


    Exposure time : 1 minute
  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling DENND1B with ab187903 at 1/200 dilution.

References

ab187903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up