Overview

  • Product nameAnti-DENND2C antibody
  • Description
    Rabbit polyclonal to DENND2C
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 360 - 409 (

    IFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQ

    ) of Human DENND2C (NP_940861)

  • Positive control
    • Transfected 293T cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab87164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 107 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe specific function of DENND2C is not yet known. There are three different isoforms, obtained by alternative splicing.
  • Database links
  • Alternative names
    • DENN/MADD domain containing 2C antibody
    • dJ1156J9.1 antibody
    • DKFZp686G0351 antibody
    • DKFZp686N1631 antibody
    • DKFZp779P1149 antibody
    • FLJ37099 antibody
    • RP5-1156J9.1 antibody
    see all

Anti-DENND2C antibody images

  • Anti-DENND2C antibody (ab87164) at 1 µg/ml (in 5% skim milk / PBS buffer) + transfected 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 107 kDa

References for Anti-DENND2C antibody (ab87164)

ab87164 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"