Overview

  • Product nameAnti-Desmoglein 2 antibody
    See all Desmoglein 2 primary antibodies
  • Description
    Rabbit polyclonal to Desmoglein 2
  • Tested applicationsSuitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Cow, Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Pig
  • Immunogen

    A synthetic peptide corresponding to a region within the N terminal amino acids 72-121 (

    KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE

    ) of Human Desmoglein 2, NP_001934.

  • Positive control
    • Hela cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab85632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 122 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 5 µg/ml.
ICC/IF Use a concentration of 5 µg/ml. PubMed: 23409002

Target

  • FunctionComponent of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
  • Tissue specificityAll of the tissues tested and carcinomas.
  • Involvement in diseaseDefects in DSG2 are the cause of familial arrhythmogenic right ventricular dysplasia type 10 (ARVD10) [MIM:610193]; also known as arrhythmogenic right ventricular cardiomyopathy 10 (ARVC10). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall.
    Genetic variations in DSG2 are the cause of susceptibility to cardiomyopathy dilated type 1BB (CMD1BB) [MIM:612877]. A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similaritiesContains 4 cadherin domains.
  • DomainCalcium may be bound by the cadherin-like repeats.
  • Cellular localizationCell membrane. Cell junction > desmosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARVC 10 antibody
    • ARVC10 antibody
    • ARVD 10 antibody
    • ARVD10 antibody
    • Cadherin family member 5 antibody
    • CDHF 5 antibody
    • CDHF5 antibody
    • CMD1BB antibody
    • Desmoglein 2 antibody
    • Desmoglein-2 antibody
    • Desmoglein2 antibody
    • DSG 2 antibody
    • DSG2 antibody
    • DSG2_HUMAN antibody
    • HDGC antibody
    • HDGC included antibody
    • Human Desmoglein colon antibody
    • MGC117034 antibody
    • MGC117036 antibody
    • MGC117037 antibody
    see all

Anti-Desmoglein 2 antibody images

  • Anti-Desmoglein 2 antibody (ab85632) at 1 µg/ml (in 5% skim milk / PBS buffer) + Hela cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 122 kDa
    Observed band size : 130 kDa (why is the actual band size different from the predicted?)
  • ab85632 staining Desmoglein 2 in human pancreatic tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

References for Anti-Desmoglein 2 antibody (ab85632)

This product has been referenced in:

See 1 Publication for this product

Product Wall

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Sheep Tissue sections (Sheep Cardiac tissue)
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Tris-EDTA buffer (PH9)
Permeabilization Yes - Tween 20 in antigen retrieval solution
Specification Sheep Cardiac tissue
Blocking step (agent) for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative Formaldehyde
Username

Abcam user community

Verified customer

Submitted Nov 22 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"