Overview

  • Product nameAnti-DHODH antibody
    See all DHODH primary antibodies
  • Description
    Rabbit polyclonal to DHODH
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG

    ) of Human DHODH (NP_001352).

  • Positive control
    • THP-1 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
  • PathwayPyrimidine metabolism; UMP biosynthesis via de novo pathway; orotate from (S)-dihydroorotate (quinone route): step 1/1.
  • Involvement in diseaseDefects in DHODH are the cause of postaxial acrofacial dysostosis (POADS) [MIM:263750]; also known as Miller syndrome. POADS is characterized by severe micrognathia, cleft lip and/or palate, hypoplasia or aplasia of the posterior elements of the limbs, coloboma of the eyelids and supernumerary nipples. POADS is a very rare disorder: only 2 multiplex families, each consisting of 2 affected siblings born to unaffected, nonconsanguineous parents, have been described among a total of around 30 reported cases.
  • Sequence similaritiesBelongs to the dihydroorotate dehydrogenase family. Type 2 subfamily.
  • Post-translational
    modifications
    The uncleaved transit peptide is required for mitochondrial targeting and proper membrane integration.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • DHOdehase antibody
    • Dhodh antibody
    • Dihydroorotate dehydrogenase (quinone) antibody
    • Dihydroorotate dehydrogenase antibody
    • Dihydroorotate dehydrogenase mitochondrial antibody
    • Dihydroorotate oxidase antibody
    • Human complement of yeast URA1 antibody
    • mitochondrial antibody
    • POADS antibody
    • PYRD_HUMAN antibody
    • URA1 antibody
    see all

Anti-DHODH antibody images

  • Anti-DHODH antibody (ab98036) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP-1 Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa

References for Anti-DHODH antibody (ab98036)

ab98036 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"