Overview

  • Product name
  • Description
    Rabbit polyclonal to DHRS2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human DHRS2 aa 1-300.
    Sequence:

    MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGF AIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLSVAGIVCHVGKAEDR EQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPA LLLSQLLPYMENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLA LELAPKDIRVNCVVPGIIKTDFSKVVRIGFMGMSLSGRTSRNIISCRGLG SQRTVQESCPSCALQMPATSTGRTLRWQATPLGSERSGGGCVAVVPGPGA


    Database link: Q13268-2

  • Positive control
    • HepG2, SKOV3, MCF7, BT474, 22RV-1 cell extracts; Mouse liver, heart and bone marrow tissue extracts; Rat liver tissue extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab194801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 31 kDa.

Target

  • Relevance
    DHRS2 belongs to the short-chain dehydrogenases/reductases (SDR) family. It may inhibit cell replication either by catalyzing the oxidation of estrogen and androgen or by converting cortisone in cortisol.
  • Cellular localization
    Mitochondrion matrix. Nucleus. Note: A minor fraction of the protein is translocated from the mitochondria to the nucleus, after cleavage of the targeting signal.
  • Database links
  • Alternative names
    • 5430405K24Rik antibody
    • Dehydrogenase/reductase (SDR family) member 2 antibody
    • Dehydrogenase/reductase member 2 antibody
    • Dehydrogenase/reductase SDR family member 2 antibody
    • Dehydrogenase/reductase SDR family member 2 mitochondria antibody
    • Dicarbonyl reductase HEP27 antibody
    • Hep27 antibody
    • HEP27 protein antibody
    • MGC143467 antibody
    • Protein D antibody
    • SDR family member antibody
    • SDR25C1 antibody
    • Short chain alcohol dehydrogenase family member antibody
    • Short chain dehydrogenase/reductase family 25C member 1 antibody
    see all

Images

  • All lanes : Anti-DHRS2 antibody (ab194801) at 1/500 dilution

    Lane 1 : HepG2 cell extract
    Lane 2 : SKOV3 cell extract
    Lane 3 : MCF7 cell extract
    Lane 4 : BT474 cell extract
    Lane 5 : 22RV-1 cell extract
    Lane 6 : Mouse liver tissue extract
    Lane 7 : Mouse heart tissue extract
    Lane 8 : Mouse bone marrow tissue extract
    Lane 9 : Rat liver tissue extract

    Predicted band size: 31 kDa

References

ab194801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up