Overview

  • Product nameAnti-DHX34 antibody
  • Description
    Rabbit polyclonal to DHX34
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 1094-1143 (

    PQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQHV

    ) of Human DHX34 (NP_055496).

  • Positive control
    • THP-1 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG

Applications

Our Abpromise guarantee covers the use of ab94989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 128 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionProbable ATP-binding RNA helicase.
  • Sequence similaritiesBelongs to the DEAD box helicase family. DEAH subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1200013B07Rik antibody
    • 1810012L18Rik antibody
    • Ddx34 antibody
    • DEAH (Asp-Glu-Ala-His) box polypeptide 34 antibody
    • DEAH box protein 34 antibody
    • Dhx34 antibody
    • DHX34_HUMAN antibody
    • EC 3.6.1.- antibody
    • HRH1 antibody
    • KIAA0134 antibody
    • mKIAA0134 antibody
    • Probable ATP-dependent RNA helicase DHX34 antibody
    see all

Anti-DHX34 antibody images

  • Anti-DHX34 antibody (ab94989) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 128 kDa

References for Anti-DHX34 antibody (ab94989)

ab94989 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your reply.

We do have an exclusive distributor in Israel. They will be happy to provide a quote for you.

Zotal Ltd
4 Habarzel St.
Tel Aviv
69710
Israel
Tel + 972 3 6492444 Website http://www.zo...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"