
  • Product name
  • Description
    Rabbit polyclonal to DHX35
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1 - 50 (AAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ R) of Human DHX35 (NP_068750)

  • Positive control
    • human fetal heart lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab86677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of this gene product which is a member of this family, has not been determined.
  • Cellular localization
    Spliceosomal complex
  • Database links
  • Alternative names
    • C20orf15 antibody
    • DDX35 antibody
    • DEAH (Asp-Glu-Ala-His) box polypeptide 35 antibody
    • DEAH box protein 35 antibody
    • KAIA0875 antibody
    see all

Anti-DHX35 antibody images

  • Anti-DHX35 antibody (ab86677) at 1 µg/ml + Human fetal heart lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 79 kDa

References for Anti-DHX35 antibody (ab86677)

ab86677 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86677.
Please use the links above to contact us or submit feedback about this product.


Sign up