Overview

  • Product name
  • Description
    Rabbit polyclonal to DHX38
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human DHX38 aa 431-526.
    Sequence:

    IPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMG VKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSIL


    Database link: Q92620

  • Positive control
    • RT4 and U251 MG cell lysates; MCF7 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

WB 1/100 - 1/250. Predicted molecular weight: 141 kDa.

Target

  • Function
    Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DEAH subfamily. PRP16 sub-subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP dependent RNA helicase DHX38 antibody
    • ATP-dependent RNA helicase DHX38 antibody
    • DDX38 antibody
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38 antibody
    • DEAH (Asp-Glu-Ala-His) box polypeptide 38 antibody
    • DEAH box protein 38 antibody
    • DHX38 antibody
    • KIAA0224 antibody
    • Pre mRNA splicing factor ATP dependent RNA helicase PRP16 antibody
    • Pre-mRNA splicing factor 16 antibody
    • Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 antibody
    • Prp16 antibody
    • PRP16 homolog of S.cerevisiae; pre-mRNA splicing factor ATP-dependent RNA helicase PRP16 antibody
    • PRP16_HUMAN antibody
    • PRPF16 antibody
    see all

Images

  • Immunofluorescent analysis of MCF7 cells (PFA-fixed/Triton X-100 permeabilized) labeling DHX38 with ab220265 at 4μg/ml (green).

  • All lanes : Anti-DHX38 antibody (ab220265) at 1/100 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate


    Predicted band size : 141 kDa

References

ab220265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up