Overview

  • Product nameAnti-DHX57 antibody
    See all DHX57 primary antibodies
  • Description
    Rabbit polyclonal to DHX57
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 1151-1200 (

    LSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG

    ) of Human DHX57 (NP_945314).

  • Positive control
    • HepG2 cell lsyate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab108178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 155 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionProbable ATP-binding RNA helicase.
  • Sequence similaritiesBelongs to the DEAD box helicase family. DEAH subfamily.
    Contains 1 C3H1-type zinc finger.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 UBA domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • DDX57 antibody
    • DEAH (Asp Glu Ala Asp/His) box polypeptide 57 antibody
    • DEAH box protein 57 antibody
    • DEAH box RNA/DNA helicase AAM73547 antibody
    • DHX 57 antibody
    • DHX57 antibody
    • DHX57_HUMAN antibody
    • FLJ32861 antibody
    • Putative ATP dependent RNA helicase DHX57 antibody
    • Putative ATP-dependent RNA helicase DHX57 antibody
    see all

Anti-DHX57 antibody images

  • Anti-DHX57 antibody (ab108178) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 155 kDa

References for Anti-DHX57 antibody (ab108178)

ab108178 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"